LL37 | 5mg
Researching Immune Defense and Antimicrobial Activity
What It Does
LL-37 is a naturally occurring antimicrobial peptide being studied for its role in immune defense and inflammatory regulation. It is a focus in research exploring broad-spectrum antimicrobial activity, immune system signaling, and tissue repair processes.
What Researchers Explore
Technical Background
LL-37 is a 37-amino acid antimicrobial peptide ([LL-37, 37 aa]) derived from the human cathelicidin precursor CAP-18. It is amphipathic and carries a net positive charge, enabling interaction with negatively charged microbial membranes.
Research indicates LL-37 disrupts microbial cell membranes directly and also modulates immune responses through pathways involving toll-like receptors (TLRs) and formyl peptide receptors. Structural studies have shown its ability to form α-helical and oligomeric configurations, contributing to its broad-spectrum activity.
Common Research Applications
Product Properties
Purity: 99%+ HPLC
Form: Lyophilized Powder
Size: 5mg
Category: Immune / Antimicrobial Research
Frequently Studied Together