Your Cart

×
Total $0.00
VIEW CART
×
Map: Wikimedia Commons, CC BY-SA 3.0
×

LL-37 | 5mg

Peptides

SKU: 1-1-27
  • Availability: In Stock

    $75.00

    There's only 24.00 left!

More From Amino Labs

Product Description

LL37 | 5mg
Researching Immune Defense and Antimicrobial Activity

What It Does
LL-37 is a naturally occurring antimicrobial peptide being studied for its role in immune defense and inflammatory regulation. It is a focus in research exploring broad-spectrum antimicrobial activity, immune system signaling, and tissue repair processes.

What Researchers Explore

  • Broad-spectrum antimicrobial mechanisms
  • Immune system activation and regulation
  • Wound healing and tissue repair pathways
  • Biofilm disruption in chronic infection models
  • Inflammatory response modulation
  • Host defense peptide activity

Technical Background
LL-37 is a 37-amino acid antimicrobial peptide ([LL-37, 37 aa]) derived from the human cathelicidin precursor CAP-18. It is amphipathic and carries a net positive charge, enabling interaction with negatively charged microbial membranes.

Research indicates LL-37 disrupts microbial cell membranes directly and also modulates immune responses through pathways involving toll-like receptors (TLRs) and formyl peptide receptors. Structural studies have shown its ability to form α-helical and oligomeric configurations, contributing to its broad-spectrum activity.

Common Research Applications

  • Antimicrobial membrane disruption studies
  • Endotoxin binding and neutralization research
  • Biofilm degradation and prevention models
  • TLR and immune signaling pathway research
  • Immune cell recruitment and differentiation studies
  • Tissue repair and wound healing research

Product Properties
Purity: 99%+ HPLC
Form: Lyophilized Powder
Size: 5mg
Category: Immune / Antimicrobial Research

Frequently Studied Together

  • Thymosin Alpha-1 (immune modulation research)
  • KPV (anti-inflammatory peptide research)
  • ARA-290 (tissue protection and inflammation research)

 

TOP